Structure of PDB 8yhe Chain F Binding Site BS01

Receptor Information
>8yhe Chain F (length=189) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPFK
GALRSALEIMLKAKGENVCDTGARPCGRCVTCSLFGSMGRAGRASVDFLI
SNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITISNPQE
KDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVA
Ligand information
>8yhe Chain M (length=46) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaaaacucuucucaugcuggauucgaaauuaggugcgcuucgcg
..............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yhe Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution3.07 Å
Binding residue
(original residue number in PDB)		G21 E22 V23 F37 R40 P50 K52 G53 A54 R56 S57 G91 S92 M93 T118 H119 L120 R121 I122 R124 K127 F133 G175 W176 L177 N178
Binding residue
(residue number reindexed from 1)		G19 E20 V21 F35 R38 P48 K50 G51 A52 R54 S55 G86 S87 M88 T113 H114 L115 R116 I117 R119 K122 F128 G170 W171 L172 N173
External links