Structure of PDB 8wh5 Chain F Binding Site BS01

Receptor Information

>8wh5 Chain F (length=87) Species: 3702 (Arabidopsis thaliana)

GAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLE
NVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGF

Ligand information

>8wh5 Chain I (length=133)

tcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgtttaaccgcccaaggg
gattactccctagtctccaggcacgtgtcagat

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8wh5 Molecular basis of chromatin remodelling by DDM1 involved in plant DNA methylation.
• Resolution: 3.58 Å
• Binding residue (original residue number in PDB): R45 I46 R78 K79 T80
• Binding residue (residue number reindexed from 1): R32 I33 R65 K66 T67

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0009414 response to water deprivation

Cellular Component

• GO:0000325 plant-type vacuole
• GO:0000786 nucleosome
• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0005730 nucleolus
• GO:0005777 peroxisome
• GO:0005794 Golgi apparatus
• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0009506 plasmodesma
• GO:0009507 chloroplast
• GO:0009536 plastid
• GO:0009579 thylakoid

External links

• PDB: RCSB:8wh5, PDBe:8wh5, PDBj:8wh5
• PDBsum: 8wh5
• PubMed: 38413824
• UniProt: P59259|H4_ARATH Histone H4 (Gene Name=At1g07660)