Structure of PDB 5dqu Chain F Binding Site BS01

Receptor Information
>5dqu Chain F (length=92) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMLVVVTENVPPRLRGRLAIWLLEVRAGVYVGDVSAKIREMIWEQIAGLA
EEGNVVMAWATNTETGFEFQTFGLNRRTPVDLDGLRLVSFLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dqu Structural and Mechanistic Basis of PAM-Dependent Spacer Acquisition in CRISPR-Cas Systems.
Resolution4.5 Å
Binding residue
(original residue number in PDB)
R77 R78 F91
Binding residue
(residue number reindexed from 1)
R76 R77 F90
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus
GO:0099048 CRISPR-cas system

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5dqu, PDBe:5dqu, PDBj:5dqu
PDBsum5dqu
PubMed26478180
UniProtP45956|CAS2_ECOLI CRISPR-associated endoribonuclease Cas2 (Gene Name=ygbF)

[Back to BioLiP]