Structure of PDB 4ivz Chain F Binding Site BS01

Receptor Information
>4ivz Chain F (length=76) Species: 211595 (Enterobacter sp. RFL1396) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIK
SLELIMKGLEVSDVVFFEMLIKEILK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ivz Structural and Mutagenic Analysis of the RM Controller Protein C.Esp1396I.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		L33 D34 T36 F37 R46 N47 L48 T49
Binding residue
(residue number reindexed from 1)		L32 D33 T35 F36 R45 N46 L47 T48
Binding affinityPDBbind-CN: Kd=1.8nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ivz, PDBe:4ivz, PDBj:4ivz
PDBsum4ivz
PubMed24887147
UniProtQ8GGH0

[Back to BioLiP]