BioLiP
Structure of PDB 7jmi Chain E Binding Site BS01
>7jmi Chain E (length=4168) Species: 9986 (Oryctolagus cuniculus)
[Search protein sequence ]
[Download receptor structure ]
[Download structure with residue number starting from 1 ]
[View receptor structure ]
QFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPD
UnboundLocalError Python 3.6.8: /usr/bin/python3
A problem occurred in a Python script. Here is the sequence of
function calls leading up to the error, in the order they occurred.
/var/www/html/BioLiP/pdb.cgi in <module> () 1701 title=pdb2title(pdbid) 1702 if bs.startswith("BS"): => 1703 pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title) 1704 else: 1705 if lig3: pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7jmi', asym_id = 'E', bs = 'BS01', title = 'Retrieving functional pathways of biomolecules from single-particle snapshots.'
/var/www/html/BioLiP/pdb.cgi in display_interaction (pdbid='7jmi', asym_id='E', bs='BS01', title='Retrieving functional pathways of biomolecules from single-particle snapshots.') 1326 display_ec(ec,csaOrig,csaRenu) 1327 if go: => 1328 display_go(go,uniprot,pdbid,asym_id) 1329 return pubmed,uniprot 1330 global display_go = <function display_go>, go = '0005216,0005219,0005262,0006811,0006816,0006874,0016020,0055085,0070588', uniprot = '', pdbid = '7jmi', asym_id = 'E'
/var/www/html/BioLiP/pdb.cgi in display_go (go='0005216,0005219,0005262,0006811,0006816,0006874,0016020,0055085,0070588', uniprot='', pdbid='7jmi', asym_id='E') 484 '''.replace("$namespace_link",namespace_link 485 ).replace("$namespace",namespace => 486 ).replace("$uniprot",u 487 )) 488 for l,(term,name) in enumerate(go2aspect[Aspect]): u undefined
UnboundLocalError : local variable 'u' referenced before assignment
