Structure of PDB 3fp7 Chain E Binding Site BS01

Receptor Information
>3fp7 Chain E (length=223) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRL
GEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARV
ATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEA
SYPGKITDNMVCVGFLEGGKDSCQGDAGGPVVCNGELQGIVSWGYGCALP
DNPGVYTKVCNYVDWIQDTIAAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3fp7 Structure of a serine protease poised to resynthesize a peptide bond.
Resolution1.46 Å
Binding residue
(original residue number in PDB)		H57 L99 D189 S190 C191 Q192 G193 D194 A195 S214 W215 G216
Binding residue
(residue number reindexed from 1)		H40 L81 D171 S172 C173 Q174 G175 D176 A177 S192 W193 G194
Enzymatic activity
Catalytic site (original residue number in PDB) G193 A195 G196
Catalytic site (residue number reindexed from 1) G175 A177 G178
Enzyme Commision number 3.4.21.4: trypsin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008236 serine-type peptidase activity
GO:0046872 metal ion binding
Biological Process
GO:0006508 proteolysis
GO:0007584 response to nutrient
GO:0007586 digestion
GO:0030574 collagen catabolic process
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3fp7, PDBe:3fp7, PDBj:3fp7
PDBsum3fp7
PubMed19549826
UniProtP00763|TRY2_RAT Anionic trypsin-2 (Gene Name=Prss2)

[Back to BioLiP]