Structure of PDB 1s9v Chain E Binding Site BS01

Receptor Information
>1s9v Chain E (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTL
LGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTIS
PSNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVM
LEMTPQRGDVYTCHVEHPSLQSPITVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1s9v Structural basis for HLA-DQ2-mediated presentation of gluten epitopes in celiac disease
Resolution2.22 Å
Binding residue
(original residue number in PDB)		Y9 F11 G13 M14 L26 S30 P56 A57 Y60 W61 V78 H81 N82 L85
Binding residue
(residue number reindexed from 1)		Y7 F9 G11 M12 L24 S28 P54 A55 Y58 W59 V76 H79 N80 L83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1s9v, PDBe:1s9v, PDBj:1s9v
PDBsum1s9v
PubMed15020763
UniProtP01920|DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain (Gene Name=HLA-DQB1)

[Back to BioLiP]