BioLiP

Structure of PDB 8qtt Chain D Binding Site BS01

Receptor Information

>8qtt Chain D (length=236) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MASGREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEERNLLSV
AYKNVIGARRASWRIISSIEQKEESRGNDDHVTAIREYRSKIETELSGIC
DGILKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEH
TLAAYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQ
AFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTS

Ligand information

>8qtt Chain N (length=5) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LFSAP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8qtt Mechanistic insights into the function of 14-3-3 proteins as negative regulators of brassinosteroid signaling.
Resolution	2.35 Å
Binding residue (original residue number in PDB)	K53 R60 R133 Y134 L178 N179 Y185 E186 I223 L226 N230
Binding residue (residue number reindexed from 1)	K53 R60 R133 Y134 L178 N179 Y185 E186 I223 L226 N230

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding

	Biological Process
GO:0009742	brassinosteroid mediated signaling pathway

	Cellular Component
GO:0000325	plant-type vacuole
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005794	Golgi apparatus
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:8qtt, PDBe:8qtt, PDBj:8qtt
PDBsum	8qtt
PubMed	38783418
UniProt	Q01525\|14332_ARATH 14-3-3-like protein GF14 omega (Gene Name=GRF2)