Structure of PDB 7jyx Chain D Binding Site BS01

Receptor Information
>7jyx Chain D (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFG
CDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAA
HVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jyx CD8 + T cell landscape in Indigenous and non-Indigenous people restricted by influenza mortality-associated HLA-A*24:02 allomorph.
Resolution2.95 Å
Binding residue
(original residue number in PDB)		M5 Y7 E63 K66 H70 T73 N77 I80 R83 Y84 F99 Y116 Y123 T143 K146 W147 A150 V152 Q156 Y159 Y171
Binding residue
(residue number reindexed from 1)		M5 Y7 E63 K66 H70 T73 N77 I80 R83 Y84 F99 Y116 Y123 T143 K146 W147 A150 V152 Q156 Y159 Y171
Enzymatic activity
Enzyme Commision number ?
External links