Structure of PDB 6vil Chain D Binding Site BS01

Receptor Information

>6vil Chain D (length=156) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RQLWKWSGNPTQRRGMKARKLFYKAIVRGKETLRIGDCAVFLSAGRPNLP
YIGRIESLWESWGSNMVVKVKWFYHPEETKLGKRQSDGKNALYQSCHEDE
NDVQTISHKCQVVGREQYEQMMRGRKYQDQQDLYYLAGTYDPTTGRLVTA
DGVPVL

Ligand information

>6vil Chain I (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TKAARKSAPATG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6vil BAHCC1 binds H3K27me3 via a conserved BAH module to mediate gene silencing and oncogenesis.
Resolution	3.301 Å
Binding residue (original residue number in PDB)	G2549 N2551
Binding residue (residue number reindexed from 1)	G63 N65

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003682	chromatin binding

View graph for
Molecular Function

External links

PDB	RCSB:6vil, PDBe:6vil, PDBj:6vil
PDBsum	6vil
PubMed	33139953
UniProt	Q3UHR0\|BAHC1_MOUSE BAH and coiled-coil domain-containing protein 1 (Gene Name=Bahcc1)

[Back to BioLiP]