Structure of PDB 6u8k Chain D Binding Site BS01

Receptor Information
>6u8k Chain D (length=222) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGGSLRLSCAASGFYISYSSIHWVRQAPGKGLEWVAS
ISPSSGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSR
YSRYRRGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKKVEPK
Ligand information
>6u8k Chain B (length=68) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggucucgcggaaccggugaguacaccggaauccaggaaacuggauuugg
gcgugcccccgcgagacc
.<<<<<<<<<<..<<<<<<....>>>>>><<<<<<<....>>>>>>>.<<
<<..>>>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6u8k Synthetic Antibody Binding to a Preorganized RNA Domain of Hepatitis C Virus Internal Ribosome Entry Site Inhibits Translation.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		Y31 Y34 S35 S36 S55 S57 S58 S60 Y62 S102 R103 Y104 S105 R106 R108 R109
Binding residue
(residue number reindexed from 1)		Y28 Y31 S32 S33 S52 S54 S55 S57 Y59 S99 R100 Y101 S102 R103 R105 R106
Binding affinityPDBbind-CN: Kd=37nM
External links