Structure of PDB 6tqs Chain D Binding Site BS01

Receptor Information
>6tqs Chain D (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIVAFKVRTTAP
EKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTG
PAELTQFWKEVPRNKVMEHRLRCHTVESS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tqs FFAT motif phosphorylation controls formation and lipid transfer function of inter-organelle contacts.
Resolution2.25 Å
Binding residue
(original residue number in PDB)
V364 R365 T366 T367 P369 R373 V374 R404 L406
Binding residue
(residue number reindexed from 1)
V45 R46 T47 T48 P50 R54 V55 R85 L87
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6tqs, PDBe:6tqs, PDBj:6tqs
PDBsum6tqs
PubMed33124732
UniProtQ8NHP6|MSPD2_HUMAN Motile sperm domain-containing protein 2 (Gene Name=MOSPD2)

[Back to BioLiP]