Structure of PDB 6qzr Chain D Binding Site BS01

Receptor Information

>6qzr Chain D (length=219) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLS
VAYKNVVGGQRAAWRVLSSIEQKSNGPEVREYREKVETELQGVCDTVLGL
LDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQ
EAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAM
ADLHDSTLIMQLLRDNLTL

Ligand information

>6qzr Chain P (length=7) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SCTWPLP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6qzr AMPK and AKT protein kinases hierarchically phosphorylate the N-terminus of the FOXO1 transcription factor, modulating interactions with 14-3-3 proteins.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	R56 R129 Y130 N175 E182
Binding residue (residue number reindexed from 1)	R61 R127 Y128 N173 E180

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008426	protein kinase C inhibitor activity
GO:0019901	protein kinase binding
GO:0042802	identical protein binding
GO:0045296	cadherin binding
GO:0050815	phosphoserine residue binding
GO:0051219	phosphoprotein binding
GO:0140311	protein sequestering activity

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0001836	release of cytochrome c from mitochondria
GO:0003334	keratinocyte development
GO:0006469	negative regulation of protein kinase activity
GO:0006611	protein export from nucleus
GO:0007165	signal transduction
GO:0008104	protein localization
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage
GO:0010482	regulation of epidermal cell division
GO:0010839	negative regulation of keratinocyte proliferation
GO:0022407	regulation of cell-cell adhesion
GO:0030216	keratinocyte differentiation
GO:0030307	positive regulation of cell growth
GO:0031424	keratinization
GO:0032880	regulation of protein localization
GO:0043588	skin development
GO:0043616	keratinocyte proliferation
GO:0045606	positive regulation of epidermal cell differentiation
GO:0045785	positive regulation of cell adhesion
GO:0045824	negative regulation of innate immune response
GO:0046827	positive regulation of protein export from nucleus
GO:0051726	regulation of cell cycle
GO:0061436	establishment of skin barrier
GO:0072089	stem cell proliferation
GO:0141156	cAMP/PKA signal transduction
GO:1903077	negative regulation of protein localization to plasma membrane
GO:1903829	positive regulation of protein localization
GO:2000647	negative regulation of stem cell proliferation

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6qzr, PDBe:6qzr, PDBj:6qzr
PDBsum	6qzr
PubMed	31308176
UniProt	P31947\|1433S_HUMAN 14-3-3 protein sigma (Gene Name=SFN)

[Back to BioLiP]

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417