Structure of PDB 6bj3 Chain D Binding Site BS01

Receptor Information
>6bj3 Chain D (length=202) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQ
GSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGEGGAQKL
VFGQGTRLTINPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSK
DSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF
PS
Ligand information
>6bj3 Chain C (length=9) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IPLTEEAEL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bj3 Isolation of a Structural Mechanism for Uncoupling T Cell Receptor Signaling from Peptide-MHC Binding.
Resolution1.898 Å
Binding residue
(original residue number in PDB)		W30 S31 G96 G97
Binding residue
(residue number reindexed from 1)		W29 S30 G95 G96
Enzymatic activity
Enzyme Commision number ?
External links