Structure of PDB 5vax Chain D Binding Site BS01

Receptor Information
>5vax Chain D (length=137) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YDNREIVMKYIHYKLSQRGYEWDDEVVHLTLRQAGDDFSRRYRRDFAEMS
SQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYG
Ligand information
>5vax Chain H (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TMENLSRRLKVTGDLFDIMSG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vax Bcl-2 complex with Beclin 1 pT108 BH3 domain
Resolution2.0 Å
Binding residue
(original residue number in PDB)		D103 F104 R107 Y108 F112 M115 H120 R129 T132 V133 E136 L137 N143 G145 R146 F153 L201 Y202 G203
Binding residue
(residue number reindexed from 1)		D37 F38 R41 Y42 F46 M49 H54 R63 T66 V67 E70 L71 N77 G79 R80 F87 L135 Y136 G137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5vax, PDBe:5vax, PDBj:5vax
PDBsum5vax
PubMed
UniProtP10415|BCL2_HUMAN Apoptosis regulator Bcl-2 (Gene Name=BCL2)

[Back to BioLiP]