Structure of PDB 4twt Chain D Binding Site BS01

Receptor Information
>4twt Chain D (length=131) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDKPVAHVVANPQAEGQLQWLNRNGVELRDNQLVVPSEGLYLIYSQVLFK
GQGCSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRPWYEPIYLGGVFQ
LEKGDRLSAEINRPDYLFAESGQVYFGIIAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4twt Subunit disassembly and inhibition of TNF alpha by a semi-synthetic bicyclic peptide.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		L57 G148 Q149
Binding residue
(residue number reindexed from 1)		L42 G122 Q123
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0006955 immune response
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4twt, PDBe:4twt, PDBj:4twt
PDBsum4twt
PubMed25614525
UniProtP01375|TNFA_HUMAN Tumor necrosis factor (Gene Name=TNF)

[Back to BioLiP]