BioLiP

Structure of PDB 4tot Chain D Binding Site BS01

Receptor Information

>4tot Chain D (length=164) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGS
TFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMA
NAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFGSKSGK
TSKKIVITDCGQLS

Ligand information

>4tot Chain F (length=11) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ALLVTPAVVLA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4tot Potent nonimmunosuppressive cyclophilin inhibitors with improved pharmaceutical properties and decreased transporter inhibition.
Resolution	2.39 Å
Binding residue (original residue number in PDB)	A59 I117 W121
Binding residue (residue number reindexed from 1)	A58 I116 W120

Enzymatic activity

Catalytic site (original residue number in PDB)	R55 F60 Q63 N102 F113 L122 H126
Catalytic site (residue number reindexed from 1)	R54 F59 Q62 N101 F112 L121 H125
Enzyme Commision number	5.2.1.8: peptidylprolyl isomerase.

Gene Ontology

	Molecular Function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity

	Biological Process
GO:0000413	protein peptidyl-prolyl isomerization
GO:0006457	protein folding

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:4tot, PDBe:4tot, PDBj:4tot
PDBsum	4tot
PubMed	25310383
UniProt	P29117\|PPIF_RAT Peptidyl-prolyl cis-trans isomerase F, mitochondrial (Gene Name=Ppif)