BioLiP

Structure of PDB 2pye Chain D Binding Site BS01

Receptor Information

>2pye Chain D (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLL
IQSSQREQTSGRLNASLDKSSGSSTLYIAASQPGDSATYLCAVRPLLDGT
YIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVS
QSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNS

Ligand information

>2pye Chain C (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SLLMWITQC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2pye Crystal structures of high affinity human T-cell receptors bound to peptide major histocompatibility complex reveal native diagonal binding geometry
Resolution	2.3 Å
Binding residue (original residue number in PDB)	Y31 R93 P94 L95 L96 G98 Y100
Binding residue (residue number reindexed from 1)	Y32 R94 P95 L96 L97 G99 Y101

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:2pye, PDBe:2pye, PDBj:2pye
PDBsum	2pye
PubMed	17644531
UniProt	P01848\|TRAC_HUMAN T cell receptor alpha chain constant (Gene Name=TRAC)

[Back to BioLiP]

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417