Structure of PDB 1loc Chain D Binding Site BS01

Receptor Information

>1loc Chain D (length=47) Species: 3858 (Lathyrus ochrus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSWYFHSELAG

Ligand information

>1loc Chain 2 (length=2) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1loc Interaction of a legume lectin with two components of the bacterial cell wall. A crystallographic study.
Resolution	2.05 Å
Binding residue (original residue number in PDB)	G29 A30 E31
Binding residue (residue number reindexed from 1)	G28 A29 E30

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005537	D-mannose binding
GO:0030246	carbohydrate binding

View graph for
Molecular Function

External links

PDB	RCSB:1loc, PDBe:1loc, PDBj:1loc
PDBsum	1loc
PubMed	8144527
UniProt	P12306\|LEC1_LATOC Mannose/glucose-specific lectin alpha 1 chain

[Back to BioLiP]