Structure of PDB 1hqr Chain D Binding Site BS01

Receptor Information
>1hqr Chain D (length=205) Species: 1314 (Streptococcus pyogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDISNVKSDLLYAYTITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISS
EMSYEASQKFKRDDHVDVFGLFYILNSHTGEYIYGGITPAQNNKVNHKLL
GNLFISGESQQNLNNKIILEKDIVTFQEIDFKIRKYLMDNYKIYDATSPY
VSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIINMKNFSHFD
IYLEK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hqr Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on MHC class II.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		N605 F607 Q613 E659 Y705
Binding residue
(residue number reindexed from 1)		N102 F104 Q110 E156 Y202
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hqr, PDBe:1hqr, PDBj:1hqr
PDBsum1hqr
PubMed11163233
UniProtQ8NKX2|SPEC_STRP8 Exotoxin type C (Gene Name=speC)

[Back to BioLiP]