Structure of PDB 1hqq Chain D Binding Site BS01

Receptor Information
>1hqq Chain D (length=119) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPA
TDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTT
EANAWKSTLVGHDTFTKVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hqq Conformational Ensemble Analysis of Ligand Binding in Streptavidin Mini-protein Complexes
Resolution1.7 Å
Binding residue
(original residue number in PDB)		V47 Y54 W79 T90 W108
Binding residue
(residue number reindexed from 1)		V32 Y39 W64 T75 W93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1hqq, PDBe:1hqq, PDBj:1hqq
PDBsum1hqq
PubMed
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]