Structure of PDB 8yte Chain C Binding Site BS01

Receptor Information
>8yte Chain C (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEF
LEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMD
Ligand information
>8yte Chain D (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GFFLYPHGFYGIVC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yte Discovery and Hit to Lead Optimization of Macrocyclic Peptides as Novel Tropomyosin Receptor Kinase A Antagonists.
Resolution2.26 Å
Binding residue
(original residue number in PDB)		P311 S312 L313 E324 S326 F329 T330 F332 P335
Binding residue
(residue number reindexed from 1)		P29 S30 L31 E42 S44 F47 T48 F50 P53
External links
PDB RCSB:8yte, PDBe:8yte, PDBj:8yte
PDBsum8yte
PubMed38950284
UniProtP04629|NTRK1_HUMAN High affinity nerve growth factor receptor (Gene Name=NTRK1)

[Back to BioLiP]