Structure of PDB 8yhd Chain C Binding Site BS01

Receptor Information
>8yhd Chain C (length=199) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPF
KGALRSALEIMLKAKGENVCDTGESRARPCGRCVTCSLFGSMGRAGRASV
DFLISNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITIS
NPQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATDRFLK
Ligand information
>8yhd Chain M (length=53) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaaaacucuucucaugcuggauucgaaauuaggugcgcuucgcguuua
agu
..................................................
...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yhd Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		G21 F37 R40 K52 G53 R56 P80 G91 S92 M93 A96 H119 L120 R121 I122 R124 K127 A129 F133 G174 G175
Binding residue
(residue number reindexed from 1)		G20 F36 R39 K51 G52 R55 P79 G90 S91 M92 A95 H118 L119 R120 I121 R123 K126 A128 F132 G173 G174
External links