Structure of PDB 8yey Chain C Binding Site BS01

Receptor Information
>8yey Chain C (length=147) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQEVSE
LQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQFPDISQES
DSPFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yey Biochemical and structural characterization of the DNA-binding properties of human TRIP4 ASCH domain reveals insights into its functional role.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		T472 A473 G555 N556
Binding residue
(residue number reindexed from 1)		T39 A40 G122 N123
External links
PDB RCSB:8yey, PDBe:8yey, PDBj:8yey
PDBsum8yey
PubMed38870938
UniProtQ15650|TRIP4_HUMAN Activating signal cointegrator 1 (Gene Name=TRIP4)

[Back to BioLiP]