Structure of PDB 8ye4 Chain C Binding Site BS01

Receptor Information
>8ye4 Chain C (length=233) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFG
CDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAA
HVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPIALGFYP
AEITLTWQRTELVETRPAGDGTFQKWAHVQHEG
Ligand information
>8ye4 Chain F (length=9) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NYNYLYRLF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ye4 Structural insights into immune escape at killer T cell epitope by SARS-CoV-2 Spike Y453F variants.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 V67 H70 T73 E76 N77 I80 Y84 M97 F99 Y116 Y123 T143 K146 W147 Q155 Q156 Y159 Y171
Binding residue
(residue number reindexed from 1)		Y7 E63 K66 V67 H70 T73 E76 N77 I80 Y84 M97 F99 Y116 Y123 T143 K146 W147 Q155 Q156 Y159 Y171
External links