Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP

Structure of PDB 6tnq Chain C Binding Site BS01

Receptor Information
>6tnq Chain C (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMGPGVDTQIFEDPREFLSHLEEYLRQVGGSEEYWLSQIQNHMNGPAKK
WWEFKQGSVKNWVEFKKEFLQYSEG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tnq Structural properties and peptide ligand binding of the capsid homology domains of human Arc.
Resolution1.3 Å
Binding residue
(original residue number in PDB)		D210 T211 Q212 I213 F214 E215 F220 L224 Y227 H245 N247 P249 A250 F271
Binding residue
(residue number reindexed from 1)		D8 T9 Q10 I11 F12 E13 F18 L22 Y25 H43 N45 P47 A48 F69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0050804 modulation of chemical synaptic transmission
GO:2000969 positive regulation of AMPA receptor activity

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6tnq, PDBe:6tnq, PDBj:6tnq
PDBsum6tnq
PubMed33732907
UniProtQ7LC44|ARC_HUMAN Activity-regulated cytoskeleton-associated protein (Gene Name=ARC)

[Back to BioLiP]

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417