Structure of PDB 6tnq Chain C Binding Site BS01

Receptor Information

>6tnq Chain C (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GAMGPGVDTQIFEDPREFLSHLEEYLRQVGGSEEYWLSQIQNHMNGPAKK
WWEFKQGSVKNWVEFKKEFLQYSEG

Ligand information

>6tnq Chain D (length=7) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TSPKFRS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6tnq Structural properties and peptide ligand binding of the capsid homology domains of human Arc.
Resolution	1.3 Å
Binding residue (original residue number in PDB)	D210 T211 Q212 I213 F214 E215 F220 L224 Y227 H245 N247 P249 A250 F271
Binding residue (residue number reindexed from 1)	D8 T9 Q10 I11 F12 E13 F18 L22 Y25 H43 N45 P47 A48 F69

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding

	Biological Process
GO:0050804	modulation of chemical synaptic transmission
GO:2000969	positive regulation of AMPA receptor activity

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6tnq, PDBe:6tnq, PDBj:6tnq
PDBsum	6tnq
PubMed	33732907
UniProt	Q7LC44\|ARC_HUMAN Activity-regulated cytoskeleton-associated protein (Gene Name=ARC)

[Back to BioLiP]