Structure of PDB 6n3f Chain C Binding Site BS01

Receptor Information
>6n3f Chain C (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDR
HPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6n3f The pre-mRNA splicing and transcription factor Tat-SF1 is a functional partner of the spliceosome SF3b1 subunit via a U2AF homology motif interface.
Resolution2.099 Å
Binding residue
(original residue number in PDB)		I287 E294 R335 W336 F337 G338
Binding residue
(residue number reindexed from 1)		I28 E35 R76 W77 F78 G79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6n3f, PDBe:6n3f, PDBj:6n3f
PDBsum6n3f
PubMed30567737
UniProtO43719|HTSF1_HUMAN 17S U2 SnRNP complex component HTATSF1 (Gene Name=HTATSF1)

[Back to BioLiP]