Structure of PDB 5ii0 Chain C Binding Site BS01

Receptor Information
>5ii0 Chain C (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAG
VLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFT
Ligand information
>5ii0 Chain F (length=12) Species: 8017 (Oncorhynchus gorbuscha) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TYPRTNTGSGTP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ii0 Type II Turn of Receptor-bound Salmon Calcitonin Revealed by X-ray Crystallography.
Resolution2.097 Å
Binding residue
(original residue number in PDB)		F39 Y41 D77 W79 F99 P100 D101 H121 E123 W128 S129 Y131 N135
Binding residue
(residue number reindexed from 1)		F1 Y3 D39 W41 F61 P62 D63 H83 E85 W90 S91 Y93 N97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004948 calcitonin receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ii0, PDBe:5ii0, PDBj:5ii0
PDBsum5ii0
PubMed27189946
UniProtP30988|CALCR_HUMAN Calcitonin receptor (Gene Name=CALCR)

[Back to BioLiP]