Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP

Structure of PDB 4j1g Chain C Binding Site BS01

Receptor Information
>4j1g Chain C (length=228) Species: 999729 (Leanyer virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DFIYDDRPAAVSSTFNPEKGYMDFITAYGKNINADNVRIFFLNHKKAKDS
LKGSPKVEVDLQFGTLRVKVVNNHNPRNRDNPVADNAITLHRLSGYLAKW
CFDEIDHGQIEEAEVKSKVVIPLAEAKGCKWGDGVALYLAFAPGAEMFLK
DFEFYPLAIDIQRVVKDGMDITFMRKVLKQRYGTKTADDWMISEVTAIQS
AVKVVAKLPWAKAGFTAAAKNFLAKFNI
Ligand information
>4j1g Chain E (length=45) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu
.............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4j1g Structure of the Leanyer orthobunyavirus nucleoprotein-RNA complex reveals unique architecture for RNA encapsidation.
Resolution2.789 Å
Binding residue
(original residue number in PDB)		A15 S17 S18 F20 L47 H49 K53 N78 H79 R97 V125 P127 L128 E130 R168 M174 F178 R180 K181 Q185 R186 A218 G219
Binding residue
(residue number reindexed from 1)		A10 S12 S13 F15 L42 H44 K48 N73 H74 R92 V120 P122 L123 E125 R163 M169 F173 R175 K176 Q180 R181 A213 G214
Binding affinityPDBbind-CN: Kd=0.166uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019013 viral nucleocapsid
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417