Structure of PDB 3mgn Chain C Binding Site BS01

Receptor Information
>3mgn Chain C (length=45) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mgn Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		V34 K38 Q41
Binding residue
(residue number reindexed from 1)		V34 K38 Q41
External links