Structure of PDB 2x4x Chain C Binding Site BS01

Receptor Information
>2x4x Chain C (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLK
LGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEG
RKSNIRKSVQIAYHRALQHRSKVQG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2x4x Molecular Basis of Histone H3K36Me3 Recognition by the Pwwp Domain of Brpf1.
Resolution1.85 Å
Binding residue
(original residue number in PDB)
G1095 Y1096 Y1099 P1119 P1121 F1147 K1151 R1152 T1153 W1154
Binding residue
(residue number reindexed from 1)
G16 Y17 Y20 P40 P42 F68 K72 R73 T74 W75
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2x4x, PDBe:2x4x, PDBj:2x4x
PDBsum2x4x
PubMed20400950
UniProtP55201|BRPF1_HUMAN Peregrin (Gene Name=BRPF1)

[Back to BioLiP]