Structure of PDB 2q9i Chain C Binding Site BS01

Receptor Information

>2q9i Chain C (length=292) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

THDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGK
DCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGS
VDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELE
DWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSD
KFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQG
GTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT

Ligand information

>2q9i Chain S (length=4) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GHRP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2q9i Probing the beta-chain hole of fibrinogen with synthetic peptides that differ at their amino termini
Resolution	2.8 Å
Binding residue (original residue number in PDB)	D301 F304 T305 F322 Q329 D330 K338 C339 H340 Y363 D364
Binding residue (residue number reindexed from 1)	D200 F203 T204 F221 Q228 D229 K237 C238 H239 Y262 D263

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005102	signaling receptor binding

	Biological Process
GO:0007596	blood coagulation
GO:0030168	platelet activation
GO:0051258	protein polymerization

	Cellular Component
GO:0005577	fibrinogen complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2q9i, PDBe:2q9i, PDBj:2q9i
PDBsum	2q9i
PubMed	17688324
UniProt	P02679\|FIBG_HUMAN Fibrinogen gamma chain (Gene Name=FGG)

[Back to BioLiP]