Structure of PDB 2eax Chain C Binding Site BS01

Receptor Information
>2eax Chain C (length=164) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CPGIVPRSVWGARETHCPRMTLPAKYGIIIHTAGRTCNISDECRLLVRDI
QSFYIDRLKSCDIGYNFLVGQDGAIYEGVGWNVQGSSTPGYDDIALGITF
MGTFTGIPPNAAALEAAQDLIQCAMVKGYLTPNYLLVGHSDVARTLSPGQ
ALYNIISTWPHFKH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2eax Structural insights into the bactericidal mechanism of human peptidoglycan recognition proteins
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Y263 S296 P298 G299 D301
Binding residue
(residue number reindexed from 1)		Y54 S87 P89 G90 D92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0008745 N-acetylmuramoyl-L-alanine amidase activity
Biological Process
GO:0009253 peptidoglycan catabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2eax, PDBe:2eax, PDBj:2eax
PDBsum2eax
PubMed17502600
UniProtQ96LB8|PGRP4_HUMAN Peptidoglycan recognition protein 4 (Gene Name=PGLYRP4)

[Back to BioLiP]