Structure of PDB 1cwe Chain C Binding Site BS01

Receptor Information
>1cwe Chain C (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQ
GEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cwe The crystal structures of the SH2 domain of p56lck complexed with two phosphopeptides suggest a gated peptide binding site.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
R12 R32 S42 H58 Y59 K60 S72 R74
Binding residue
(residue number reindexed from 1)
R10 R30 S40 H56 Y57 K58 S70 R72
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1cwe, PDBe:1cwe, PDBj:1cwe
PDBsum1cwe
PubMed7532720
UniProtP06239|LCK_HUMAN Tyrosine-protein kinase Lck (Gene Name=LCK)

[Back to BioLiP]