Structure of PDB 6qzc Chain BBB Binding Site BS01

Receptor Information
>6qzc Chain BBB (length=191) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRA
VTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKV
TVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQ
NGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Ligand information
>6qzc Chain CCC (length=16) Species: 11320 (Influenza A virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QARQMVQAMRTIGTHP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qzc CD4+T Cells Recognize Conserved Influenza A Epitopes through Shared Patterns of V-Gene Usage and Complementary Biochemical Features.
Resolution1.64 Å
Binding residue
(original residue number in PDB)
L11 F13 P56 D57 Y60 W61 L67 R71 A74 Y78 H81 N82
Binding residue
(residue number reindexed from 1)
L12 F14 P57 D58 Y61 W62 L68 R72 A75 Y79 H82 N83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6qzc, PDBe:6qzc, PDBj:6qzc
PDBsum6qzc
PubMed32668259
UniProtP01911|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]