Structure of PDB 9asi Chain B Binding Site BS01

Receptor Information
>9asi Chain B (length=297) Species: 1360 (Lactococcus lactis subsp. lactis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKIIKLYFESPVHFGEKRLSESKITFSADTLFSALMIEAVGLGKEDEFYQ
LASNNLVKFSDAFPFIDQYYYIPKPMFNLKLEKEDENPSKAFKKLLYVPI
DSLEDYLSGGLDAYFERESFNLGKLALSEKVQQHDFKDSEPYNVGTFTFK
ENTGLYVLIEQTHPLLEELLENLQYSGIGGKRNSGYGKFKFEILEDSDIE
DLFSAKGNRKILLSGALPKDAELEQALKNASYLLERRGGFVQSDTYATNL
VKKQDLYVFKSGSTFENSFDGDIYQVGKKGNHPVYKYAKSFFLEVSV
Ligand information
>9asi Chain R (length=37) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgagaacgcagcaccagcuguccaaccugaagaaga
.....................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9asi Molecular basis for cA6 synthesis by a type III-A CRISPR-Cas enzyme and its conversion to cA4 production.
Resolution2.79 Å
Binding residue
(original residue number in PDB)		H13 G15 E16 K17 T30 S33 A34 M36 I37 K130 V131 Q132 Q133 P141 Y142 G177 I178 G179 G180 R182 N183 R236 G239 F240 V241 Q242 L250 K252 H282 P283 V284 Y285
Binding residue
(residue number reindexed from 1)		H13 G15 E16 K17 T30 S33 A34 M36 I37 K130 V131 Q132 Q133 P141 Y142 G177 I178 G179 G180 R182 N183 R236 G239 F240 V241 Q242 L250 K252 H282 P283 V284 Y285
External links