Structure of PDB 8hep Chain B Binding Site BS01

Receptor Information
>8hep Chain B (length=166) Species: 637887 (Acetivibrio thermocellus DSM 1313) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSVELVIDETCRVLEVRPQNKDGEQLISGLELLDKNVEDVVYELINRSIS
FGFVKADDNRKIVLISGALNDKRNELKTKKENDEAELTELLDNIKARVDR
IDNIKVRTITATSRERKDALKYGLSMGKYCLYLEAQELNGSITIDEVHDM
SISDMIEKLEHHHHHH
Ligand information
>8hep Chain A (length=10) Species: 637887 (Acetivibrio thermocellus DSM 1313) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MYGYICVDIN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hep Essential autoproteolysis of bacterial anti-sigma factor RsgI for transmembrane signal transduction.
ResolutionN/A
Binding residue
(original residue number in PDB)
P11 S12 V13 E14 L15 V16 I17 E19 R27 Q29 V64 K71 I72 L74 S76 G77 A78 N80 R83 E96 L97 R126 S135 M136 K138 S161 I162
Binding residue
(residue number reindexed from 1)
P1 S2 V3 E4 L5 V6 I7 E9 R17 Q19 V54 K61 I62 L64 S66 G67 A68 N70 R73 E86 L87 R116 S125 M126 K128 S151 I152
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8hep, PDBe:8hep, PDBj:8hep
PDBsum8hep
PubMed37418529
UniProtA3DBH1|RSGI1_ACET2 Anti-sigma-I factor RsgI1 (Gene Name=rsgI1)

[Back to BioLiP]