Structure of PDB 8ei9 Chain B Binding Site BS01

Receptor Information
>8ei9 Chain B (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHI
VYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVV
Ligand information
>8ei9 Chain C (length=17) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ANDCFKAAWQCIIWLHQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ei9 Recognition and reprogramming of E3 ubiquitin ligase surfaces by alpha-helical peptides
Resolution3.9 Å
Binding residue
(original residue number in PDB)		M50 L54 L57 I61 M62 Y67 Q72 V93 K94 Y100
Binding residue
(residue number reindexed from 1)		M26 L30 L33 I37 M38 Y43 Q48 V69 K70 Y76
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ei9, PDBe:8ei9, PDBj:8ei9
PDBsum8ei9
PubMed37914719
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]