Structure of PDB 8a0w Chain B Binding Site BS01

Receptor Information
>8a0w Chain B (length=68) Species: 666 (Vibrio cholerae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVPNGQAVT
LLKLVQRHPETLSHIAEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8a0w Fuzzy DNA recognition by a prokaryotic transcription factor
Resolution2.334 Å
Binding residue
(original residue number in PDB)		R56 E71 Q75 R77
Binding residue
(residue number reindexed from 1)		R20 E35 Q39 R41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a0w, PDBe:8a0w, PDBj:8a0w
PDBsum8a0w
PubMed38600130
UniProtQ9KMA5|HIGA2_VIBCH Antitoxin HigA-2 (Gene Name=higA-2)

[Back to BioLiP]