Structure of PDB 7uxp Chain B Binding Site BS01

Receptor Information
>7uxp Chain B (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTVPKDLYVVEYGSNMTIECKFIVYWEMEDKNIIQFVHGEEDLKVQHSSY
RQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISADYKRITVKVNA
Ligand information
>7uxp Chain D (length=17) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DPALWQCVFAARSCYEE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uxp De novo mapping of alpha-helix recognition sites on protein surfaces using unbiased libraries.
Resolution2.62 Å
Binding residue
(original residue number in PDB)		Y56 W57 E58 D61 N63 V76 H78 M115 I116 S117
Binding residue
(residue number reindexed from 1)		Y25 W26 E27 D30 N32 V45 H47 M84 I85 S86
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7uxp, PDBe:7uxp, PDBj:7uxp
PDBsum7uxp
PubMed36534810
UniProtQ9NZQ7|PD1L1_HUMAN Programmed cell death 1 ligand 1 (Gene Name=CD274)

[Back to BioLiP]