Structure of PDB 7lkb Chain B Binding Site BS01

Receptor Information
>7lkb Chain B (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVQSGAEVKKPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWI
KAGNGNTRYSQKFQDRVTITRDTSASTAYMELSSLRSEDTAVYYCALLTV
ITPDDTFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEP
Ligand information
>7lkb Chain D (length=15) Species: 36329 (Plasmodium falciparum 3D7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPDPNANPNVDPNAN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lkb Vaccination in a humanized mouse model elicits highly protective PfCSP-targeting anti-malarial antibodies.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Y32 A33 H35 W50 K52 R58 L95 T96 V97 I98 T99 P100
Binding residue
(residue number reindexed from 1)		Y31 A32 H34 W49 K51 R58 L98 T99 V100 I101 T102 P103
External links