Structure of PDB 7ds8 Chain B Binding Site BS01

Receptor Information
>7ds8 Chain B (length=242) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARD
KVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANN
AFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIH
VVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDET
VSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ds8 Structural Insights into the Regulation of Actin Capping Protein by Twinfilin C-terminal Tail.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		D7 L10 D11 R14 R15 S42 D44 Y64 W122 V153 T170 T194 Q196
Binding residue
(residue number reindexed from 1)		D5 L8 D9 R12 R13 S40 D42 Y62 W120 V151 T168 T192 Q194
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0030036 actin cytoskeleton organization
GO:0051016 barbed-end actin filament capping
Cellular Component
GO:0005737 cytoplasm
GO:0008290 F-actin capping protein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ds8, PDBe:7ds8, PDBj:7ds8
PDBsum7ds8
PubMed33639213
UniProtP14315|CAPZB_CHICK F-actin-capping protein subunit beta isoforms 1 and 2 (Gene Name=CAPZB)

[Back to BioLiP]