BioLiP

Structure of PDB 7ds8 Chain B Binding Site BS01

Receptor Information

>7ds8 Chain B (length=242) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARD
KVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANN
AFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIH
VVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDET
VSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR

Ligand information

>7ds8 Chain C (length=12) Species: 9606,10090 [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LLHLTANRPKGP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7ds8 Structural Insights into the Regulation of Actin Capping Protein by Twinfilin C-terminal Tail.
Resolution	1.95 Å
Binding residue (original residue number in PDB)	D7 L10 D11 R14 R15 S42 D44 Y64 W122 V153 T170 T194 Q196
Binding residue (residue number reindexed from 1)	D5 L8 D9 R12 R13 S40 D42 Y62 W120 V151 T168 T192 Q194

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003779	actin binding

	Biological Process
GO:0030036	actin cytoskeleton organization
GO:0051016	barbed-end actin filament capping

	Cellular Component
GO:0005737	cytoplasm
GO:0008290	F-actin capping protein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:7ds8, PDBe:7ds8, PDBj:7ds8
PDBsum	7ds8
PubMed	33639213
UniProt	P14315\|CAPZB_CHICK F-actin-capping protein subunit beta isoforms 1 and 2 (Gene Name=CAPZB)