Structure of PDB 6v7k Chain B Binding Site BS01

Receptor Information
>6v7k Chain B (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCN
DEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPK
Ligand information
>6v7k Chain X (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CDIHVKWEWPCFMRP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6v7k High-Resolution Structure for a Complex Between One Copy of a Non-Helical Foldamer and VEGF
Resolution2.5 Å
Binding residue
(original residue number in PDB)		F17 M18 Y21 Y25 N62 D63
Binding residue
(residue number reindexed from 1)		F5 M6 Y9 Y13 N50 D51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008083 growth factor activity
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6v7k, PDBe:6v7k, PDBj:6v7k
PDBsum6v7k
PubMed
UniProtP15692|VEGFA_HUMAN Vascular endothelial growth factor A, long form (Gene Name=VEGFA)

[Back to BioLiP]