Structure of PDB 5wzx Chain B Binding Site BS01

Receptor Information
>5wzx Chain B (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELTPDQQTLLHFIMDSYNKQRMPQEITNKNFLILTEMATNHVQVLVEFTK
KLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPLEERIRNSGISD
EYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQE
PLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDH
KFTPLLCEIWDV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wzx Identification of an Oleanane-Type Triterpene Hedragonic Acid as a Novel Farnesoid X Receptor Ligand with Liver Protective Effects and Anti-inflammatory Activity
Resolution2.95 Å
Binding residue
(original residue number in PDB)
V312 K316 H326 Q329 I330 K334 L477 E480
Binding residue
(residue number reindexed from 1)
V46 K50 H60 Q63 I64 K68 L205 E208
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
GO:0032052 bile acid binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0038183 bile acid signaling pathway

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5wzx, PDBe:5wzx, PDBj:5wzx
PDBsum5wzx
PubMed29162643
UniProtQ96RI1|NR1H4_HUMAN Bile acid receptor (Gene Name=NR1H4)

[Back to BioLiP]