BioLiP

Structure of PDB 5wzx Chain B Binding Site BS01

Receptor Information

>5wzx Chain B (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ELTPDQQTLLHFIMDSYNKQRMPQEITNKNFLILTEMATNHVQVLVEFTK
KLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPLEERIRNSGISD
EYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQE
PLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDH
KFTPLLCEIWDV

Ligand information

>5wzx Chain D (length=11) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NALLRYLLDKD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5wzx Identification of an Oleanane-Type Triterpene Hedragonic Acid as a Novel Farnesoid X Receptor Ligand with Liver Protective Effects and Anti-inflammatory Activity
Resolution	2.95 Å
Binding residue (original residue number in PDB)	V312 K316 H326 Q329 I330 K334 L477 E480
Binding residue (residue number reindexed from 1)	V46 K50 H60 Q63 I64 K68 L205 E208

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity
GO:0032052	bile acid binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0038183	bile acid signaling pathway

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:5wzx, PDBe:5wzx, PDBj:5wzx
PDBsum	5wzx
PubMed	29162643
UniProt	Q96RI1\|NR1H4_HUMAN Bile acid receptor (Gene Name=NR1H4)