Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP

Structure of PDB 5w43 Chain B Binding Site BS01

Receptor Information
>5w43 Chain B (length=194) Species: 511145 (Escherichia coli str. K-12 substr. MG1655) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAH
VLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDL
DIEGIVLKQGAPTDLPKALAALQKPESVSRLLEKIKRLSPKESEVLRLFA
EGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5w43 Structural Basis for DNA Recognition by the Two-Component Response Regulator RcsB.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		V168 T169 S183 K186 K187
Binding residue
(residue number reindexed from 1)		V155 T156 S170 K173 K174
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001216 DNA-binding transcription activator activity
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0031346 positive regulation of cell projection organization
GO:0043470 regulation of carbohydrate catabolic process
GO:0044011 single-species biofilm formation on inanimate substrate
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0046677 response to antibiotic
GO:1901913 regulation of capsule organization
GO:1902021 regulation of bacterial-type flagellum-dependent cell motility
GO:1990451 cellular stress response to acidic pH
Cellular Component
GO:0005667 transcription regulator complex
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5w43, PDBe:5w43, PDBj:5w43
PDBsum5w43
PubMed29487239
UniProtP0DMC7|RCSB_ECOLI Transcriptional regulatory protein RcsB (Gene Name=rcsB)

[Back to BioLiP]

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417