Structure of PDB 5t6j Chain B Binding Site BS01

Receptor Information
>5t6j Chain B (length=92) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNANDAAEVALYERLLQLRVLPGASDVHDVRFVFGDDSRCWIEVAMHGDH
VIGNSHPALDPKSRATLEHVLTVQGDLAAFLVVARDMLLASL
Ligand information
>5t6j Chain C (length=12) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QQLLKGLSLSFS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t6j Structure of the MIND Complex Defines a Regulatory Focus for Yeast Kinetochore Assembly.
Resolution1.752 Å
Binding residue
(original residue number in PDB)		L150 P151 V156 H157 M175
Binding residue
(residue number reindexed from 1)		L21 P22 V27 H28 M46
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5t6j, PDBe:5t6j, PDBj:5t6j
PDBsum5t6j
PubMed27881300
UniProtP40014|SPC25_YEAST Kinetochore protein SPC25 (Gene Name=SPC25)

[Back to BioLiP]