Structure of PDB 4z0u Chain B Binding Site BS01

Receptor Information
>4z0u Chain B (length=155) Species: 331111 (Escherichia coli O139:H28 str. E24377A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELM
AAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKN
VDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTG
YQVEV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z0u Interaction with Single-stranded DNA-binding Protein Stimulates Escherichia coli Ribonuclease HI Enzymatic Activity.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
K3 Y28 R31 K33 A58 L59 K60 C63
Binding residue
(residue number reindexed from 1)
K3 Y28 R31 K33 A58 L59 K60 C63
Enzymatic activity
Catalytic site (original residue number in PDB) D10 G11 E48 D70 H124 D134
Catalytic site (residue number reindexed from 1) D10 G11 E48 D70 H124 D134
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003676 nucleic acid binding
GO:0004519 endonuclease activity
GO:0004523 RNA-DNA hybrid ribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0006401 RNA catabolic process
GO:0043137 DNA replication, removal of RNA primer
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4z0u, PDBe:4z0u, PDBj:4z0u
PDBsum4z0u
PubMed25903123
UniProtA7ZHV1|RNH_ECO24 Ribonuclease H (Gene Name=rnhA)

[Back to BioLiP]