BioLiP

Structure of PDB 4z0u Chain B Binding Site BS01

Receptor Information

>4z0u Chain B (length=155) Species: 331111 (Escherichia coli O139:H28 str. E24377A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELM
AAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKN
VDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTG
YQVEV

Ligand information

>4z0u Chain E (length=4) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DIPF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4z0u Interaction with Single-stranded DNA-binding Protein Stimulates Escherichia coli Ribonuclease HI Enzymatic Activity.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	K3 Y28 R31 K33 A58 L59 K60 C63
Binding residue (residue number reindexed from 1)	K3 Y28 R31 K33 A58 L59 K60 C63

Enzymatic activity

Catalytic site (original residue number in PDB)	D10 G11 E48 D70 H124 D134
Catalytic site (residue number reindexed from 1)	D10 G11 E48 D70 H124 D134
Enzyme Commision number	3.1.26.4: ribonuclease H.

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003676	nucleic acid binding
GO:0004519	endonuclease activity
GO:0004523	RNA-DNA hybrid ribonuclease activity
GO:0046872	metal ion binding

	Biological Process
GO:0006401	RNA catabolic process
GO:0043137	DNA replication, removal of RNA primer

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:4z0u, PDBe:4z0u, PDBj:4z0u
PDBsum	4z0u
PubMed	25903123
UniProt	A7ZHV1\|RNH_ECO24 Ribonuclease H (Gene Name=rnhA)