Structure of PDB 4ydv Chain B Binding Site BS01

Receptor Information
>4ydv Chain B (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGGGVFKPGGSLRLSCEASGFTFTEYYMTWVRQAPGKGLEWLAY
ISKNGEYSKYSPSSNGRFTISRDNAKNSVFLQLDRLSADDTAVYYCARAD
GLTYFSELLQYIFDLWGQGARVTVSSASTKGPSVFPLAPSGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKRVEP
Ligand information
>4ydv Chain Q (length=11) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WGCSGKLICTT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ydv Human Non-neutralizing HIV-1 Envelope Monoclonal Antibodies Limit the Number of Founder Viruses during SHIV Mucosal Infection in Rhesus Macaques.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
E31 Y32 Y33 K52A A95 D96 G97 L98 T99 Y100 L100E Q100F
Binding residue
(residue number reindexed from 1)
E31 Y32 Y33 K53 A99 D100 G101 L102 T103 Y104 L109 Q110
Enzymatic activity
Enzyme Commision number ?
External links