Structure of PDB 4itz Chain B Binding Site BS01

Receptor Information
>4itz Chain B (length=121) Species: 5855 (Plasmodium vivax) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEQVHLTEDGGVVKTILRKGEGGEENAPKKGNEVTVHYVGKLESSGKVFD
SSRERNVPFKFHLGQGEVIKGWDICVASMTKNEKCSVRLDSKYGYGEEGC
GESIPGNSVLIFEIELISFRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4itz Structural insights into substrate binding by PvFKBP35, a peptidylprolyl cis-trans isomerase from the human malarial parasite Plasmodium vivax.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		G71 V73
Binding residue
(residue number reindexed from 1)		G66 V68
Enzymatic activity
Catalytic site (original residue number in PDB) Y43 F54 D55 I74 Y100 F117
Catalytic site (residue number reindexed from 1) Y38 F49 D50 I69 Y95 F112
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity

View graph for
Molecular Function
External links
PDB RCSB:4itz, PDBe:4itz, PDBj:4itz
PDBsum4itz
PubMed23435727
UniProtA5K8X6

[Back to BioLiP]