BioLiP

Structure of PDB 4iqr Chain B Binding Site BS01

Receptor Information

>4iqr Chain B (length=308) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKD
KRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQ
AEVLSDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVAL
LRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRIL
DELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSL
EDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNL
LQEMLLGG

Ligand information

>4iqr Chain C (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggaactaggtcaaaggtcag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4iqr Multidomain integration in the structure of the HNF-4 alpha nuclear receptor complex.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	H62 Y63 K72 R76 R80 Q122 E124 R125 R127 S129
Binding residue (residue number reindexed from 1)	H14 Y15 K24 R28 R32 Q74 E76 R77 R79 S81
Binding affinity	PDBbind-CN: Kd=80nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0003707	nuclear steroid receptor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:4iqr, PDBe:4iqr, PDBj:4iqr
PDBsum	4iqr
PubMed	23485969
UniProt	P41235\|HNF4A_HUMAN Hepatocyte nuclear factor 4-alpha (Gene Name=HNF4A)